PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA29G00037
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 330aa    MW: 38045.8 Da    PI: 4.8452
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA29G00037genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.31.8e-182370148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+++++ +G g+W++ +r+ g+ Rt+k+c++rw++yl
       AA29G00037 23 RGPWTAEEDFKLINYIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYL 70
                     89********************************************97 PP

2Myb_DNA-binding50.45e-1676119146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
       AA29G00037  76 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 119
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.6881870IPR017930Myb domain
SuperFamilySSF466891.99E-3120117IPR009057Homeodomain-like
SMARTSM007174.1E-152272IPR001005SANT/Myb domain
PfamPF002492.0E-162370IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-232477IPR009057Homeodomain-like
CDDcd001672.74E-112570No hitNo description
PROSITE profilePS5129422.91771125IPR017930Myb domain
SMARTSM007172.9E-1475123IPR001005SANT/Myb domain
PfamPF002498.3E-1576119IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2278124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDEKGRILKN NNNTMEDEMD LKRGPWTAEE DFKLINYIAT HGEGRWNSLS RCAGLQRTGK  60
SCRLRWLNYL RPDVRRGNIT LEEQLLILEL HSRWGNRWSK IAQYLPGRTD NEIKNYWRTR  120
VQKHAKQLKC DVNSQQFKDT MKYLWMPRLI ERIQSASGST VASATATATA GSAATSSCIT  180
TSTDQFMTYD YNNNNNMGQQ QQFGVINKND NYVTPENSSV AVSPASDLTE YYYTAPNPNP  240
NPNPEYYSGQ IENNYYPVGP QMLTDNYLDY NGLLDEDLTA IQEQEQEQSN FNWFENINGA  300
SNSSSSDSLW NVEDLWFLQQ QQQHLNNGNF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-252011724120MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00334DAPTransfer from AT3G06490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002882474.11e-167botrytis-susceptible1, myb domain protein 108
SwissprotQ9LDE11e-156MY108_ARATH; Transcription factor MYB108
TrEMBLD7L5I61e-167D7L5I6_ARALL; Botrytis-susceptible1, myb domain protein 108
STRINGfgenesh2_kg.3__656__AT3G06490.11e-166(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.11e-137myb domain protein 108